PDB entry 2hir

View 2hir on RCSB PDB site
Description: solution structure of recombinant hirudin and the lys-47 (right arrow) glu mutant. a nuclear magnetic resonance and hybrid distance geometry-dynamical simulated annealing study
Class: coagulation inhibitor
Keywords: coagulation inhibitor
Deposited on 1988-12-19, released 1990-01-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-29, with a file datestamp of 2017-11-24.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: hirudin variant-1
    Species: Hirudo medicinalis [TaxId:6421]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2hira_

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2hirA (A:)
    vvytdctesgqnlclcegsnvcgqgnkcilgsdgeknqcvtgegtpkpqshndgdfeeip
    eeylq
    

    Sequence, based on observed residues (ATOM records): (download)
    >2hirA (A:)
    vvytdctesgqnlclcegsnvcgqgnkcilgsdgeknqcvtgegtpkpq