PDB entry 2hap

View 2hap on RCSB PDB site
Description: structure of a hap1-18/DNA complex reveals that protein/DNA interactions can have direct allosteric effects on transcriptional activation
Class: gene regulation/DNA
Keywords: complex transcription factor/DNA, asymmetry, transcriptional activation, hyperactive mutant
Deposited on 1998-09-17, released 1999-05-18
The last revision prior to the SCOP 1.55 freeze date was dated 1999-11-10, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.5 Å
R-factor: 0.248
AEROSPACI score: 0.24 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: DNA (5'-d(*ap*cp*gp*cp*tp*ap*tp*tp*ap*tp*cp*gp*cp*tp*ap*tp*tp*ap*gp*t)-3')
  Species: synthetic, synthetic
  
• Chain 'B':
  Compound: DNA (5'-d(*ap*cp*tp*ap*ap*tp*ap*gp*cp*gp*ap*tp*ap*ap*tp*ap*gp*cp*gp*t)-3')
  Species: synthetic, synthetic
  
• Chain 'C':
  Compound: protein (heme activator protein)
  Species: Saccharomyces cerevisiae
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12351 (0-End)
  Domains in SCOP 1.55: d2hapc1, d2hapc2
• Chain 'D':
  Compound: protein (heme activator protein)
  Species: Saccharomyces cerevisiae
  Database cross-references and differences (RAF-indexed):
  • Uniprot P12351
  Domains in SCOP 1.55: d2hapd1, d2hapd2
• Heterogens: ZN, HOH

PDB Chain Sequences:

• Chain 'A':
  No sequence available.
  
  
• Chain 'B':
  No sequence available.
  
  
• Chain 'C':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hapC (C:)
  rkrnriplrcticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnel
  kklrervkslektlsk
  

  
  
• Chain 'D':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2hapD (D:)
  krnriplrcticrkrkvkcdklrphcqqctktgvahlchymeqtwaeeaekellkdnevk
  klrervkslektlsk