PDB entry 2gtt

View 2gtt on RCSB PDB site
Description: Crystal structure of the rabies virus nucleoprotein-RNA complex
Class: viral protein, RNA binding protein
Keywords: protein-RNA complex, rabies virus, nucleoprotein, viral protein, RNA binding protein
Deposited on 2006-04-28, released 2006-09-19
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 3.49 Å
R-factor: N/A
AEROSPACI score: 0.07 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtta1
  • Chain 'B':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttb1
  • Chain 'C':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttc1
  • Chain 'D':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttd1
  • Chain 'E':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtte1
  • Chain 'F':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttf1
  • Chain 'G':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttg1
  • Chain 'H':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtth1
  • Chain 'I':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtti1
  • Chain 'J':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttj1
  • Chain 'K':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttk1
  • Chain 'L':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttl1
  • Chain 'M':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttm1
  • Chain 'N':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttn1
  • Chain 'O':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtto1
  • Chain 'P':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttp1
  • Chain 'Q':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttq1
  • Chain 'R':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttr1
  • Chain 'S':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gtts1
  • Chain 'T':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttt1
  • Chain 'U':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttu1
  • Chain 'V':
    Compound: nucleoprotein
    Species: Rabies virus [TaxId:11292]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2gttv1
  • Chain 'W':
    Compound: RNA (99-mer)
  • Chain 'X':
    Compound: RNA (99-mer)

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2gttA (A:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttA (A:)
    ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
    dpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpehas
    lvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstipn
    frflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyffh
    knfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgqv
    rslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaetrspeavyt
    rimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2gttB (B:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttB (B:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpeha
    slvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstip
    nfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyff
    hknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgq
    vrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaetrspeavyt
    rimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2gttC (C:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttC (C:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkivegnwaltggmeltrdptvpe
    haslvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwst
    ipnfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareaily
    ffhknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcym
    gqvrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaetrspea
    vytrimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2gttD (D:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttD (D:)
    ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
    dpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpehas
    lvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstipn
    frflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyffh
    knfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgqv
    rslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaetrspeavytr
    immnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'E':
    Sequence, based on SEQRES records: (download)
    >2gttE (E:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttE (E:)
    ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
    dpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpehas
    lvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstipn
    frflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyffh
    knfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgqv
    rslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaetrspeavytr
    immnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'F':
    Sequence, based on SEQRES records: (download)
    >2gttF (F:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttF (F:)
    ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
    dpddvcsylaaamqffegtcpedwtsygiviarkgdkivegnwaltggmeltrdptvpeh
    aslvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwsti
    pnfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyf
    fhknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymg
    qvrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaelttrspe
    avytrimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'G':
    Sequence, based on SEQRES records: (download)
    >2gttG (G:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttG (G:)
    ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
    dpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpehas
    lvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstipn
    frflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyffh
    knfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgqv
    rslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaatrspeavytr
    immnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'H':
    Sequence, based on SEQRES records: (download)
    >2gttH (H:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttH (H:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpeha
    slvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstip
    nfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyff
    hknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgq
    vrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeetrspeavytr
    immnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >2gttI (I:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttI (I:)
    ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
    dpddvcsylaaamqffegtcpedwtsygiviarkgdkiegnwaltggmeltrdptvpeha
    slvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstip
    nfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyff
    hknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgq
    vrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaeltrspeav
    ytrimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'J':
    Sequence, based on SEQRES records: (download)
    >2gttJ (J:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttJ (J:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpeha
    slvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstip
    nfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyff
    hknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgq
    vrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaeltetrspe
    avytrimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'K':
    Sequence, based on SEQRES records: (download)
    >2gttK (K:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttK (K:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpeha
    slvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstip
    nfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyff
    hknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgq
    vrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaatrspeavyt
    rimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'L':
    Sequence, based on SEQRES records: (download)
    >2gttL (L:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttL (L:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkiegnwaltggmeltrdptvpeh
    aslvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwsti
    pnfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyf
    fhknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymg
    qvrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaeltetrsp
    eavytrimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'M':
    Sequence, based on SEQRES records: (download)
    >2gttM (M:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttM (M:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkivegnwaltggmeltrdptvpe
    haslvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwst
    ipnfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareaily
    ffhknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcym
    gqvrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaetrspea
    vytrimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'N':
    Sequence, based on SEQRES records: (download)
    >2gttN (N:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttN (N:)
    ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
    dpddvcsylaaamqffegtcpedwtsygiviarkgdkivegnwaltggmeltrdptvpeh
    aslvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwsti
    pnfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyf
    fhknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymg
    qvrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaelttrspe
    avytrimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'O':
    Sequence, based on SEQRES records: (download)
    >2gttO (O:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttO (O:)
    ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
    dpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpehas
    lvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstipn
    frflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyffh
    knfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgqv
    rslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaatrspeavytr
    immnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'P':
    Sequence, based on SEQRES records: (download)
    >2gttP (P:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttP (P:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpeha
    slvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstip
    nfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyff
    hknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgq
    vrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyetrspeavytri
    mmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'Q':
    Sequence, based on SEQRES records: (download)
    >2gttQ (Q:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttQ (Q:)
    ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
    dpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpehas
    lvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstipn
    frflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyffh
    knfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgqv
    rslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaeltrspeavy
    trimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'R':
    Sequence, based on SEQRES records: (download)
    >2gttR (R:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttR (R:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpeha
    slvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstip
    nfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyff
    hknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgq
    vrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaatrspeavyt
    rimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'S':
    Sequence, based on SEQRES records: (download)
    >2gttS (S:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttS (S:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpeha
    slvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstip
    nfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyff
    hknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgq
    vrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaatrspeavyt
    rimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >2gttT (T:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttT (T:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpeha
    slvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstip
    nfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyff
    hknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgq
    vrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeatrspeavytr
    immnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'U':
    Sequence, based on SEQRES records: (download)
    >2gttU (U:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttU (U:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpeha
    slvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstip
    nfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyff
    hknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgq
    vrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaeltrspeav
    ytrimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'V':
    Sequence, based on SEQRES records: (download)
    >2gttV (V:)
    mdadkivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgm
    saakldpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnw
    altggmeltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvk
    ivehhtlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglv
    sftgfikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspy
    ssnavghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrff
    rdekelqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrsh
    irryvsvssnhqarpnsfaeflnktyssds
    

    Sequence, based on observed residues (ATOM records): (download)
    >2gttV (V:)
    kivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaak
    ldpddvcsylaaamqffegtcpedwtsygiviarkgdkivegnwaltggmeltrdptvpe
    haslvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwst
    ipnfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareaily
    ffhknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcym
    gqvrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaeetrspe
    avytrimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss
    

  • Chain 'W':
    No sequence available.

  • Chain 'X':
    No sequence available.