Lineage for d2gtts1 (2gtt S:6-448)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2016186Fold a.260: Rhabdovirus nucleoprotein-like [140808] (1 superfamily)
    multihelical, consist of two helical domains; each domain contains a buried helix
  4. 2016187Superfamily a.260.1: Rhabdovirus nucleoprotein-like [140809] (1 family) (S)
    automatically mapped to Pfam PF00945
  5. 2016188Family a.260.1.1: Rhabdovirus nucleocapsid protein [140810] (2 protein domains)
    Pfam PF00945; RNA-binding homooligomeric protein
  6. 2016189Protein Nucleoprotein [140811] (2 species)
  7. 2016190Species Rabies virus [TaxId:11292] [140812] (1 PDB entry)
    Uniprot Q7TBN9 6-448
  8. 2016209Domain d2gtts1: 2gtt S:6-448 [135700]
    automatically matched to 2GTT A:6-448
    protein/RNA complex

Details for d2gtts1

PDB Entry: 2gtt (more details), 3.49 Å

PDB Description: crystal structure of the rabies virus nucleoprotein-rna complex
PDB Compounds: (S:) nucleoprotein

SCOPe Domain Sequences for d2gtts1:

Sequence, based on SEQRES records: (download)

>d2gtts1 a.260.1.1 (S:6-448) Nucleoprotein {Rabies virus [TaxId: 11292]}
ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
dpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnwaltgg
meltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvkivehh
tlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglvsftgf
ikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnav
ghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrffrdeke
lqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrshirryv
svssnhqarpnsfaeflnktyss

Sequence, based on observed residues (ATOM records): (download)

>d2gtts1 a.260.1.1 (S:6-448) Nucleoprotein {Rabies virus [TaxId: 11292]}
ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
dpddvcsylaaamqffegtcpedwtsygiviarkgdkignwaltggmeltrdptvpehas
lvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwstipn
frflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyffh
knfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymgqv
rslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaatrspeavytr
immnggrlkrshirryvsvssnhqarpnsfaeflnktyss

SCOPe Domain Coordinates for d2gtts1:

Click to download the PDB-style file with coordinates for d2gtts1.
(The format of our PDB-style files is described here.)

Timeline for d2gtts1: