Lineage for d2gttc1 (2gtt C:6-448)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.260: Rhabdovirus nucleoprotein-like [140808] (1 superfamily)
    multihelical, consist of two helical domains; each domain contains a buried helix
  4. Superfamily a.260.1: Rhabdovirus nucleoprotein-like [140809] (1 family) (S)
    automatically mapped to Pfam PF00945
  5. Family a.260.1.1: Rhabdovirus nucleocapsid protein [140810] (2 proteins)
    Pfam PF00945; RNA-binding homooligomeric protein
  6. Protein Nucleoprotein [140811] (2 species)
  7. Species Rabies virus [TaxId:11292] [140812] (1 PDB entry)
    Uniprot Q7TBN9 6-448
  8. Domain d2gttc1: 2gtt C:6-448 [135684]
    automatically matched to 2GTT A:6-448
    protein/RNA complex

Details for d2gttc1

PDB Entry: 2gtt (more details), 3.4899999999999998 Å

PDB Description: crystal structure of the rabies virus nucleoprotein-rna complex
PDB Compounds: (C:) nucleoprotein

SCOPe Domain Sequences for d2gttc1:

Sequence, based on SEQRES records: (download)

>d2gttc1 a.260.1.1 (C:6-448) Nucleoprotein {Rabies virus [TaxId: 11292]}
ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
dpddvcsylaaamqffegtcpedwtsygiviarkgdkitpgslveikrtdvegnwaltgg
meltrdptvpehaslvglllslyrlskisgqntgnyktniadrieqifetapfvkivehh
tlmtthkmcanwstipnfrflagtydmffsriehlysairvgtvvtayedcsglvsftgf
ikqinltareailyffhknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnav
ghvfnlihfvgcymgqvrslnatviaacaphemsvlggylgeeffgkgtferrffrdeke
lqeyeaaeltktdvaladdgtvnsddedyfsgetrspeavytrimmnggrlkrshirryv
svssnhqarpnsfaeflnktyss

Sequence, based on observed residues (ATOM records): (download)

>d2gttc1 a.260.1.1 (C:6-448) Nucleoprotein {Rabies virus [TaxId: 11292]}
ivfkvnnqvvslkpeiivdqheykypaikdlkkpcitlgkapdlnkayksvlsgmsaakl
dpddvcsylaaamqffegtcpedwtsygiviarkgdkivegnwaltggmeltrdptvpeh
aslvglllslyrlskisgqntgnyktniadrieqifetapfvkivehhtthkmcanwsti
pnfrflagtydmffsriehlysairvgtvvtayedcsglvsftgfikqinltareailyf
fhknfeeeirrmfepgqetavphsyfihfrslglsgkspyssnavghvfnlihfvgcymg
qvrslnatviaacaphemsvlggylgeeffgkgtferrffrdekelqeyeaaetrspeav
ytrimmnggrlkrshirryvsvssnhqarpnsfaeflnktyss

SCOPe Domain Coordinates for d2gttc1 are not available.

Timeline for d2gttc1:

Domains from other chains:
(mouse over for more information)
d2gtta1, d2gttb1, d2gttd1, d2gtte1, d2gttf1, d2gttg1, d2gtth1, d2gtti1, d2gttj1, d2gttk1, d2gttl1, d2gttm1, d2gttn1, d2gtto1, d2gttp1, d2gttq1, d2gttr1, d2gtts1, d2gttt1, d2gttu1, d2gttv1