PDB entry 2ge3

View 2ge3 on RCSB PDB site
Description: Crystal structure of Probable acetyltransferase from Agrobacterium tumefaciens
Class: transferase
Keywords: acetyltransferase, Agrobacterium tumefaciens, Structural genomics, PSI, Protein Structure Initiative, Midwest Center for Structural Genomics, MCSG
Deposited on 2006-03-17, released 2006-04-18
The last revision prior to the SCOP 1.73 freeze date was dated 2006-04-18, with a file datestamp of 2007-06-04.
Experiment type: XRAY
Resolution: 2.25 Å
R-factor: 0.194
AEROSPACI score: 0.25 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Probable acetyltransferase
    Species: Agrobacterium tumefaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UD38
      • modified residue (52)
      • modified residue (90)
      • modified residue (106)
      • modified residue (163)
    Domains in SCOP 1.73: d2ge3a1
  • Chain 'B':
    Compound: Probable acetyltransferase
    Species: Agrobacterium tumefaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UD38
      • modified residue (52)
      • modified residue (90)
      • modified residue (106)
      • modified residue (163)
    Domains in SCOP 1.73: d2ge3b1
  • Chain 'C':
    Compound: Probable acetyltransferase
    Species: Agrobacterium tumefaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UD38
      • modified residue (52)
      • modified residue (90)
      • modified residue (106)
      • modified residue (163)
    Domains in SCOP 1.73: d2ge3c1
  • Chain 'D':
    Compound: Probable acetyltransferase
    Species: Agrobacterium tumefaciens
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UD38 (Start-169)
      • modified residue (52)
      • modified residue (90)
      • modified residue (106)
      • modified residue (163)
    Domains in SCOP 1.73: d2ge3d1
  • Heterogens: ACO, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2ge3A (A:)
    mmalddtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpq
    fvaiadgdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglh
    rielsvhadnaraialyekigfahegrardavsidghyidslnmaiifgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ge3A (A:)
    dtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaia
    dgdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhriels
    vhadnaraialyekigfahegrardavsidghyidslnmaiifg
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2ge3B (B:)
    mmalddtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpq
    fvaiadgdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglh
    rielsvhadnaraialyekigfahegrardavsidghyidslnmaiifgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ge3B (B:)
    tvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaiad
    gdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhrielsv
    hadnaraialyekigfahegrardavsidghyidslnmaiifg
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2ge3C (C:)
    mmalddtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpq
    fvaiadgdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglh
    rielsvhadnaraialyekigfahegrardavsidghyidslnmaiifgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ge3C (C:)
    dtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaia
    dgdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhriels
    vhadnaraialyekigfahegrardavsidghyidslnmaiifg
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2ge3D (D:)
    mmalddtvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpq
    fvaiadgdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglh
    rielsvhadnaraialyekigfahegrardavsidghyidslnmaiifgn
    

    Sequence, based on observed residues (ATOM records): (download)
    >2ge3D (D:)
    tvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaiad
    gdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhrielsv
    hadnaraialyekigfahegrardavsidghyidslnmaiifgn