Lineage for d2ge3b1 (2ge3 B:7-169)

  1. Root: SCOP 1.73
  2. 713694Class d: Alpha and beta proteins (a+b) [53931] (334 folds)
  3. 730983Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 730984Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) (S)
  5. 730985Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins)
  6. 731203Protein Probable acetyltransferase Atu2290 [143660] (1 species)
  7. 731204Species Agrobacterium tumefaciens [TaxId:358] [143661] (1 PDB entry)
  8. 731206Domain d2ge3b1: 2ge3 B:7-169 [135045]
    automatically matched to 2GE3 A:6-169
    complexed with aco

Details for d2ge3b1

PDB Entry: 2ge3 (more details), 2.25 Å

PDB Description: Crystal structure of Probable acetyltransferase from Agrobacterium tumefaciens
PDB Compounds: (B:) Probable acetyltransferase

SCOP Domain Sequences for d2ge3b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ge3b1 d.108.1.1 (B:7-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]}
tvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaiad
gdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhrielsv
hadnaraialyekigfahegrardavsidghyidslnmaiifg

SCOP Domain Coordinates for d2ge3b1:

Click to download the PDB-style file with coordinates for d2ge3b1.
(The format of our PDB-style files is described here.)

Timeline for d2ge3b1: