Class d: Alpha and beta proteins (a+b) [53931] (334 folds) |
Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily) 3 layers: a/b/a; contains mixed beta-sheet |
Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (9 families) |
Family d.108.1.1: N-acetyl transferase, NAT [55730] (56 proteins) |
Protein Probable acetyltransferase Atu2290 [143660] (1 species) |
Species Agrobacterium tumefaciens [TaxId:358] [143661] (1 PDB entry) |
Domain d2ge3d1: 2ge3 D:7-169 [135047] automatically matched to 2GE3 A:6-169 complexed with aco |
PDB Entry: 2ge3 (more details), 2.25 Å
SCOP Domain Sequences for d2ge3d1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2ge3d1 d.108.1.1 (D:7-169) Probable acetyltransferase Atu2290 {Agrobacterium tumefaciens [TaxId: 358]} tvtikpiraehvesfhraldavsrerkylsfleappleavrafvldmiendhpqfvaiad gdvigwcdirrqdratrahcgtlgmgilpayrnkglgarlmrrtldaahefglhrielsv hadnaraialyekigfahegrardavsidghyidslnmaiifg
Timeline for d2ge3d1: