PDB entry 2fm0

View 2fm0 on RCSB PDB site
Description: Crystal structure of PDE4D in complex with L-869298
Class: hydrolase
Keywords: PDE. enantiomer binding, inhibitor selectivity, cAMP signalling, crystal structure, HYDROLASE
Deposited on 2006-01-06, released 2006-03-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.223
AEROSPACI score: 0.43 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fm0a_
  • Chain 'B':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fm0b_
  • Chain 'C':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fm0c_
  • Chain 'D':
    Compound: cAMP-specific 3',5'-cyclic phosphodiesterase 4D
    Species: Homo sapiens [TaxId:9606]
    Gene: PDE4D2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2fm0d_
  • Heterogens: ZN, MG, M98, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2fm0A (A:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fm0A (A:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipq
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2fm0B (B:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fm0B (B:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstipq
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2fm0C (C:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fm0C (C:)
    teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
    lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
    gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
    divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
    lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
    dlvhpdaqdildtlednrewyqstipq
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2fm0D (D:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipqspspapddpeegrqgqtekfqfeltl
    e
    

    Sequence, based on observed residues (ATOM records): (download)
    >2fm0D (D:)
    iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip
    vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa
    ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq
    slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad
    lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh
    plwetwadlvhpdaqdildtlednrewyqstipq