![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily) multihelical; consists of two different alpha-helical bundles |
![]() | Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) ![]() |
![]() | Family a.211.1.2: PDEase [48548] (7 proteins) Pfam PF00233; multihelical; can be divided into three subdomains |
![]() | Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [89152] (89 PDB entries) Uniprot Q08499 388-713 |
![]() | Domain d2fm0d_: 2fm0 D: [133755] automated match to d1f0ja_ complexed with m98, mg, zn |
PDB Entry: 2fm0 (more details), 2 Å
SCOPe Domain Sequences for d2fm0d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d2fm0d_ a.211.1.2 (D:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]} iprfgvkteqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkip vdtlitylmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasa ihdvdhpgvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrq slrkmvidivlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcad lsnptkplqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivh plwetwadlvhpdaqdildtlednrewyqstipq
Timeline for d2fm0d_: