Lineage for d2fm0b_ (2fm0 B:)

  1. Root: SCOPe 2.08
  2. Class a: All alpha proteins [46456] (290 folds)
  3. Fold a.211: HD-domain/PDEase-like [109603] (1 superfamily)
    multihelical; consists of two different alpha-helical bundles
  4. Superfamily a.211.1: HD-domain/PDEase-like [109604] (9 families) (S)
  5. Family a.211.1.2: PDEase [48548] (7 proteins)
    Pfam PF00233; multihelical; can be divided into three subdomains
  6. Protein Catalytic domain of cyclic nucleotide phosphodiesterase pde4d [89151] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [89152] (82 PDB entries)
    Uniprot Q08499 388-713
  8. Domain d2fm0b_: 2fm0 B: [133753]
    automated match to d1f0ja_
    complexed with m98, mg, zn

Details for d2fm0b_

PDB Entry: 2fm0 (more details), 2 Å

PDB Description: Crystal structure of PDE4D in complex with L-869298
PDB Compounds: (B:) cAMP-specific 3',5'-cyclic phosphodiesterase 4D

SCOPe Domain Sequences for d2fm0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2fm0b_ a.211.1.2 (B:) Catalytic domain of cyclic nucleotide phosphodiesterase pde4d {Human (Homo sapiens) [TaxId: 9606]}
teqedvlakeledvnkwglhvfriaelsgnrpltvimhtifqerdllktfkipvdtlity
lmtledhyhadvayhnnihaadvvqsthvllstpaleavftdleilaaifasaihdvdhp
gvsnqflintnselalmyndssvlenhhlavgfkllqeencdifqnltkkqrqslrkmvi
divlatdmskhmnlladlktmvetkkvtssgvllldnysdriqvlqnmvhcadlsnptkp
lqlyrqwtdrimeeffrqgdrerergmeispmcdkhnasveksqvgfidyivhplwetwa
dlvhpdaqdildtlednrewyqstipq

SCOPe Domain Coordinates for d2fm0b_ are not available.

Timeline for d2fm0b_:

Domains from other chains:
(mouse over for more information)
d2fm0a_, d2fm0c_, d2fm0d_