PDB entry 2f3m

View 2f3m on RCSB PDB site
Description: Structure of human GLUTATHIONE S-TRANSFERASE M1A-1A complexed with 1-(S-(GLUTATHIONYL)-2,4,6-TRINITROCYCLOHEXADIENATE ANION
Class: transferase
Keywords: transferase, glutathione, conjugation, detoxification, cytosolic, dimer, active site, transition state analogue
Deposited on 2005-11-21, released 2006-04-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-18, with a file datestamp of 2017-10-13.
Experiment type: XRAY
Resolution: 2.7 Å
R-factor: N/A
AEROSPACI score: 0.17 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3ma1, d2f3ma2
  • Chain 'B':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3mb1, d2f3mb2
  • Chain 'C':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3mc1, d2f3mc2
  • Chain 'D':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3md1, d2f3md2
  • Chain 'E':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3me1, d2f3me2
  • Chain 'F':
    Compound: Glutathione S-transferase Mu 1
    Species: Homo sapiens [TaxId:9606]
    Gene: GSTM1, GST1
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d2f3mf1, d2f3mf2
  • Heterogens: GTD, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f3mA (A:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f3mB (B:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2f3mC (C:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

    Sequence, based on observed residues (ATOM records): (download)
    >2f3mC (C:)
    pmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnlp
    ylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpefe
    klkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpnl
    kdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f3mD (D:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f3mE (E:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk
    

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2f3mF (F:)
    mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
    pylidgahkitqsnailcyiarkhnlcgeteeekirvdilenqtmdnhmqlgmicynpef
    eklkpkyleelpeklklyseflgkrpwfagnkitfvdflvydvldlhrifepkcldafpn
    lkdfisrfeglekisaymkssrflprpvfskmavwgnk