SCOPe 2.08: Domain d2f3mb1: 2f3m B:85-217

Lineage for d2f3mb1 (2f3m B:85-217)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
   core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix

4. Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families)
   this domains follows the thioredoxin-like N-terminal domain

5. Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)

6. Protein Class mu GST [81348] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [47622] (17 PDB entries)
   Uniprot P09488 P28161

8. Domain d2f3mb1: 2f3m B:85-217 [132875]
   Other proteins in same PDB: d2f3ma2, d2f3mb2, d2f3mc2, d2f3md2, d2f3me2, d2f3mf2
   automated match to d1xw6a1
   complexed with gtd

Details for d2f3mb1

PDB Entry: 2f3m, 2.7 Å

PDB Description: structure of human glutathione s-transferase m1a-1a complexed with 1- (s-(glutathionyl)-2,4,6-trinitrocyclohexadienate anion

PDB Compounds: (B:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d2f3mb1:

Sequence; same for both SEQRES and ATOM records:

>d2f3mb1 a.45.1.1 (B:85-217) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
lcgeteeekirvdilenqtmdnhmqlgmicynpefeklkpkyleelpeklklyseflgkr
pwfagnkitfvdflvydvldlhrifepkcldafpnlkdfisrfeglekisaymkssrflp
rpvfskmavwgnk

Timeline for d2f3mb1:

• d2f3mb1 first appeared in SCOP 1.73
  
• d2f3mb1 appears in SCOPe 2.07