SCOPe 2.08: Domain d2f3mb2: 2f3m B:0-84

Lineage for d2f3mb2 (2f3m B:0-84)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
   core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest

4. Superfamily c.47.1: Thioredoxin-like [52833] (24 families)

5. Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)

6. Protein Class mu GST [81359] (3 species)

7. Species Human (Homo sapiens) [TaxId:9606] [52867] (17 PDB entries)
   Uniprot P09488 ! Uniprot P28161

8. Domain d2f3mb2: 2f3m B:0-84 [132876]
   Other proteins in same PDB: d2f3ma1, d2f3mb1, d2f3mc1, d2f3md1, d2f3me1, d2f3mf1
   automated match to d1xw6a2
   complexed with gtd

Details for d2f3mb2

PDB Entry: 2f3m, 2.7 Å

PDB Description: structure of human glutathione s-transferase m1a-1a complexed with 1- (s-(glutathionyl)-2,4,6-trinitrocyclohexadienate anion

PDB Compounds: (B:) Glutathione S-transferase Mu 1

SCOPe Domain Sequences for d2f3mb2:

Sequence; same for both SEQRES and ATOM records:

>d2f3mb2 c.47.1.5 (B:0-84) Class mu GST {Human (Homo sapiens) [TaxId: 9606]}
mpmilgywdirglahairllleytdssyeekkytmgdapdydrsqwlnekfklgldfpnl
pylidgahkitqsnailcyiarkhn

Timeline for d2f3mb2:

• d2f3mb2 first appeared in SCOP 1.73
  
• d2f3mb2 appears in SCOPe 2.07