PDB entry 2f2d

View 2f2d on RCSB PDB site
Description: Solution structure of the FK506-binding domain of human FKBP38
Class: isomerase
Keywords: beta half-barrel, PPIase, immunophilin, ISOMERASE
Deposited on 2005-11-16, released 2006-05-02
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: 38 kDa FK-506 binding protein homolog, FKBP38
  Species: Homo sapiens [TaxId:9606]
  Gene: FKBP8, FKBP38
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q14318 (2-120)
    • cloning artifact (0-1)
  Domains in SCOPe 2.04: d2f2da_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2f2dA (A:)
  mrewldilgngllrkktlvpgppgssrpvkgqvvtvhlqtslengtrvqeepelvftlgd
  cdviqaldlsvplmdvgetamvtadskycygpqgrspyipphaalclevtlktavdgpdl
  e