PDB entry 2d90

View 2d90 on RCSB PDB site
Description: Solution structure of the third PDZ domain of PDZ domain containing protein 1
Class: Protein binding
Keywords: PDZ domain, PDZ domain containing 1, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, Protein binding
Deposited on 2005-12-08, released 2006-12-08
The last revision prior to the SCOPe 2.04 freeze date was dated 2010-03-31, with a file datestamp of 2010-03-26.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: PDZ domain containing protein 1
    Species: Mus musculus [TaxId:10090]
    Gene: Pdzk1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9JIL4 (7-95)
      • expression tag (0-6)
      • expression tag (96-101)
    Domains in SCOPe 2.04: d2d90a_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2d90A (A:)
    gssgssgrvvvikkgsngygfylragpeqkgqiikdiepgspaeaaglknndlvvavngk
    svealdhdgvvemirkggdqttllvldkeaesiyslsgpssg