SCOPe 2.04: Domain d2d90a_: 2d90 A:

Lineage for d2d90a_ (2d90 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.36: PDZ domain-like [50155] (1 superfamily)
   contains barrel, partly opened; n*=4, S*=8; meander; capped by alpha-helix

4. Superfamily b.36.1: PDZ domain-like [50156] (7 families)
   peptide-binding domain

5. Family b.36.1.0: automated matches [191362] (1 protein)
   not a true family

6. Protein automated matches [190436] (5 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [189959] (12 PDB entries)

8. Domain d2d90a_: 2d90 A: [241517]
   automated match to d1ueza_

Details for d2d90a_

PDB Entry: 2d90

PDB Description: solution structure of the third pdz domain of pdz domain containing protein 1

PDB Compounds: (A:) PDZ domain containing protein 1

SCOPe Domain Sequences for d2d90a_:

Sequence; same for both SEQRES and ATOM records:

>d2d90a_ b.36.1.0 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
gssgssgrvvvikkgsngygfylragpeqkgqiikdiepgspaeaaglknndlvvavngk
svealdhdgvvemirkggdqttllvldkeaesiyslsgpssg

Timeline for d2d90a_:

• d2d90a_ is new in SCOPe 2.04-stable
  
• d2d90a_ appears in SCOPe 2.05
  
• d2d90a_ appears in the current release, SCOPe 2.08, called d2d90a1