PDB entry 2crd

View 2crd on RCSB PDB site
Description: analysis of side-chain organization on a refined model of charybdotoxin: structural and functional implications
Deposited on 1993-02-17, released 1993-07-15
The last revision prior to the SCOP 1.55 freeze date was dated 1993-07-15, with a file datestamp of 1994-01-31.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.09 (click here for full SPACI score report)

Chains and heterogens:

  • Chain ' ':
    Domains in SCOP 1.55: d2crd__

PDB Chain Sequences:

  • Chain ' ':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2crd_ (-)
    eftnvscttskecwsvcqrlhntsrgkcmnkkcrcys