PDB entry 2cr7

View 2cr7 on RCSB PDB site
Description: Solution structure of the first PAH domain of the mouse transcriptional repressor SIN3B
Class: gene regulation
Keywords: Paired amphipathic helix repeat; Transcriptional repressor, Structural Genomics, NPPSFA, National Project on Protein Structural and Functional Analyses, RIKEN Structural Genomics/Proteomics Initiative, RSGI, GENE REGULATION
Deposited on 2005-05-20, released 2005-11-20
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.03 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: paired amphipathic helix protein sin3b
  Species: Mus musculus [TaxId:10090]
  Gene: SIN3B
  Database cross-references and differences (RAF-indexed):
  • Uniprot Q62141 (7-73)
    • cloning artifact (0-6)
    • cloning artifact (74-79)
  Domains in SCOPe 2.07: d2cr7a1, d2cr7a2, d2cr7a3

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >2cr7A (A:)
  gssgssgvhvedaltyldqvkirfgsdpatyngfleimkefksqsidtpgvirrvsqlfh
  ehpdlivgfnaflpsgpssg