![]() | Class a: All alpha proteins [46456] (289 folds) |
![]() | Fold a.59: PAH2 domain [47761] (1 superfamily) 4 helices; open up-and-down bundle; binds alpha-helical peptides |
![]() | Superfamily a.59.1: PAH2 domain [47762] (1 family) ![]() |
![]() | Family a.59.1.1: PAH2 domain [47763] (3 proteins) |
![]() | Protein Sin3B [47764] (1 species) |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [47765] (4 PDB entries) |
![]() | Domain d2cr7a1: 2cr7 A:8-74 [241473] Other proteins in same PDB: d2cr7a2, d2cr7a3 automated match to d2f05a1 |
PDB Entry: 2cr7 (more details)
SCOPe Domain Sequences for d2cr7a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2cr7a1 a.59.1.1 (A:8-74) Sin3B {Mouse (Mus musculus) [TaxId: 10090]} vhvedaltyldqvkirfgsdpatyngfleimkefksqsidtpgvirrvsqlfhehpdliv gfnaflp
Timeline for d2cr7a1: