PDB entry 2clt

View 2clt on RCSB PDB site
Description: crystal structure of the active form (full-length) of human fibroblast collagenase.
Class: hydrolase
Keywords: extracellular matrix, fibroblast collagenase, zinc, calcium, zymogen, protease, collagen, autocatalytic cleavage, matrix metalloproteinases, hydrolase, polymorphism, glycoprotein, metal-binding, inhibitor-free, metalloprotease, collagen degradation
Deposited on 2006-04-29, released 2006-08-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.67 Å
R-factor: 0.223
AEROSPACI score: 0.26 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: interstitial collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03956 (0-366)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d2clta1, d2clta2
  • Chain 'B':
    Compound: interstitial collagenase
    Species: Homo sapiens [TaxId:9606]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P03956 (0-366)
      • engineered mutation (119)
    Domains in SCOPe 2.07: d2cltb1, d2cltb2
  • Heterogens: CA, ZN, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cltA (A:)
    fvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
    misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaaha
    lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpigpqtpkacd
    skltfdaittirgevmffkdrfymrtnpfypevelnfisvfwpqlpngleaayefadrde
    vrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhidaalseentgktyffvankywr
    ydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpktkriltlqk
    answfnc
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2cltB (B:)
    fvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
    misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaaha
    lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpigpqtpkacd
    skltfdaittirgevmffkdrfymrtnpfypevelnfisvfwpqlpngleaayefadrde
    vrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhidaalseentgktyffvankywr
    ydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpktkriltlqk
    answfnc