SCOPe 2.08: Domain d2clta2: 2clt A:81-252

Lineage for d2clta2 (2clt A:81-252)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.92: Zincin-like [55485] (2 superfamilies)
   contains mixed beta sheet with connection over free side of the sheet

4. Superfamily d.92.1: Metalloproteases ('zincins'), catalytic domain [55486] (18 families)

5. Family d.92.1.11: Matrix metalloproteases, catalytic domain [55528] (14 proteins)

6. Protein automated matches [190182] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186920] (33 PDB entries)

8. Domain d2clta2: 2clt A:81-252 [130587]
   Other proteins in same PDB: d2clta1, d2cltb1
   automated match to d1fbla2
   complexed with ca, zn

Details for d2clta2

PDB Entry: 2clt, 2.67 Å

PDB Description: crystal structure of the active form (full-length) of human fibroblast collagenase.

PDB Compounds: (A:) interstitial collagenase

SCOPe Domain Sequences for d2clta2:

Sequence; same for both SEQRES and ATOM records:

>d2clta2 d.92.1.11 (A:81-252) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fvltegnprweqthltyrienytpdlpradvdhaiekafqlwsnvtpltftkvsegqadi
misfvrgdhrdnspfdgpggnlahafqpgpgiggdahfdederwtnnfreynlhrvaaha
lghslglshstdigalmypsytfsgdvqlaqddidgiqaiygrsqnpvqpig

Timeline for d2clta2:

• d2clta2 first appeared in SCOP 1.73
  
• d2clta2 appears in SCOPe 2.07