Lineage for d2cltb1 (2clt B:253-447)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2807265Fold b.66: 4-bladed beta-propeller [50922] (1 superfamily)
    consists of four 4-stranded beta-sheet motifs; meander
  4. 2807266Superfamily b.66.1: Hemopexin-like domain [50923] (2 families) (S)
  5. 2807267Family b.66.1.1: Hemopexin-like domain [50924] (6 proteins)
  6. Protein automated matches [226897] (1 species)
    not a true protein
  7. Species Human (Homo sapiens) [TaxId:9606] [225112] (1 PDB entry)
  8. 2807300Domain d2cltb1: 2clt B:253-447 [130588]
    Other proteins in same PDB: d2clta2, d2cltb2
    automated match to d1fbla1
    complexed with ca, zn

Details for d2cltb1

PDB Entry: 2clt (more details), 2.67 Å

PDB Description: crystal structure of the active form (full-length) of human fibroblast collagenase.
PDB Compounds: (B:) interstitial collagenase

SCOPe Domain Sequences for d2cltb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2cltb1 b.66.1.1 (B:253-447) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pqtpkacdskltfdaittirgevmffkdrfymrtnpfypevelnfisvfwpqlpngleaa
yefadrdevrffkgnkywavqgqnvlhgypkdiyssfgfprtvkhidaalseentgktyf
fvankywrydeykrsmdpgypkmiahdfpgighkvdavfmkdgffyffhgtrqykfdpkt
kriltlqkanswfnc

SCOPe Domain Coordinates for d2cltb1:

Click to download the PDB-style file with coordinates for d2cltb1.
(The format of our PDB-style files is described here.)

Timeline for d2cltb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2cltb2