PDB entry 2b4g

View 2b4g on RCSB PDB site
Description: dihydroorotate dehydrogenase
Class: oxidoreductase
Keywords: STRUCTURAL GENOMICS, PSI, Protein Structure Initiative, Structural Genomics of Pathogenic Protozoa Consortium, SGPP, OXIDOREDUCTASE
Deposited on 2005-09-23, released 2005-10-11
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.95 Å
R-factor: N/A
AEROSPACI score: 0.32 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: dihydroorotate dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83 (Start-316)
      • see remark 999 (118)
    Domains in SCOPe 2.07: d2b4ga1
  • Chain 'B':
    Compound: dihydroorotate dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83 (4-316)
      • see remark 999 (118)
    Domains in SCOPe 2.07: d2b4gb_
  • Chain 'C':
    Compound: dihydroorotate dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83 (4-316)
      • see remark 999 (118)
    Domains in SCOPe 2.07: d2b4gc_
  • Chain 'D':
    Compound: dihydroorotate dehydrogenase
    Species: Trypanosoma brucei [TaxId:5691]
    Gene: Tb927.5.3830
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q57U83 (Start-316)
      • see remark 999 (118)
    Domains in SCOPe 2.07: d2b4gd_
  • Heterogens: BR, FMN, ORO, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2b4gA (A:)
    gpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpe
    pryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvp
    itkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfd
    maaavlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvna
    ffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtn
    kgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4gA (A:)
    slkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryfg
    lplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitkek
    gtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaav
    lndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrrc
    pdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgykt
    ldefrgrvktmd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >2b4gB (B:)
    gpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpe
    pryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvp
    itkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfd
    maaavlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvna
    ffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtn
    kgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4gB (B:)
    mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf
    glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke
    kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa
    vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr
    cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk
    tldefrgrvktmd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2b4gC (C:)
    gpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpe
    pryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvp
    itkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfd
    maaavlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvna
    ffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtn
    kgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4gC (C:)
    mslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryf
    glplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitke
    kgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaa
    vlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrr
    cpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgyk
    tldefrgrvktmd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >2b4gD (D:)
    gpgsmslkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpe
    pryfglplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvp
    itkekgtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfd
    maaavlndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvna
    ffrrcpdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtn
    kgyktldefrgrvktmd
    

    Sequence, based on observed residues (ATOM records): (download)
    >2b4gD (D:)
    slkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryfg
    lplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitkek
    gtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaav
    lndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrrc
    pdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgykt
    ldefrgrvktmd