Lineage for d2b4gd_ (2b4g D:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2827845Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2828459Family c.1.4.0: automated matches [191310] (1 protein)
    not a true family
  6. 2828460Protein automated matches [190048] (31 species)
    not a true protein
  7. 2828752Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [186962] (1 PDB entry)
  8. 2828755Domain d2b4gd_: 2b4g D: [127832]
    Other proteins in same PDB: d2b4ga1
    automated match to d1dora_
    complexed with br, fmn, gol, oro

Details for d2b4gd_

PDB Entry: 2b4g (more details), 1.95 Å

PDB Description: dihydroorotate dehydrogenase
PDB Compounds: (D:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d2b4gd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4gd_ c.1.4.0 (D:) automated matches {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
slkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryfg
lplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitkek
gtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaav
lndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrrc
pdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgykt
ldefrgrvktmd

SCOPe Domain Coordinates for d2b4gd_:

Click to download the PDB-style file with coordinates for d2b4gd_.
(The format of our PDB-style files is described here.)

Timeline for d2b4gd_: