Lineage for d2b4ga1 (2b4g A:2-313)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080000Superfamily c.1.4: FMN-linked oxidoreductases [51395] (2 families) (S)
  5. 2080001Family c.1.4.1: FMN-linked oxidoreductases [51396] (19 protein domains)
  6. 2080046Protein Dihydroorotate dehydrogenase [51397] (8 species)
  7. 2080212Species Trypanosome (Trypanosoma brucei) [TaxId:5691] [141758] (1 PDB entry)
    Uniprot Q57U83 2-313
  8. 2080213Domain d2b4ga1: 2b4g A:2-313 [127829]
    Other proteins in same PDB: d2b4gb_, d2b4gc_, d2b4gd_
    complexed with br, fmn, gol, oro

Details for d2b4ga1

PDB Entry: 2b4g (more details), 1.95 Å

PDB Description: dihydroorotate dehydrogenase
PDB Compounds: (A:) dihydroorotate dehydrogenase

SCOPe Domain Sequences for d2b4ga1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2b4ga1 c.1.4.1 (A:2-313) Dihydroorotate dehydrogenase {Trypanosome (Trypanosoma brucei) [TaxId: 5691]}
slkvnilghefsnpfmnaagvlctteedlrrmtesesgsligksctlaprtgnpepryfg
lplgsinsmglpnlgvdfylsyaaqthdysrkplflsmsglsveesvemvkklvpitkek
gtilelnlscpnvpgkpqvgydfdttrtylqkvseayglpfgvkmppyfdiahfdmaaav
lndfplvkfitcvnsignglvidpanetvvikpkqgfgglggkyvlptalanvnaffrrc
pdklvfgcggvysgeeaflhilagasmvqvgtalhdegpiifarlnkelqeimtnkgykt
ldefrgrvktmd

SCOPe Domain Coordinates for d2b4ga1:

Click to download the PDB-style file with coordinates for d2b4ga1.
(The format of our PDB-style files is described here.)

Timeline for d2b4ga1: