PDB entry 2aq0

View 2aq0 on RCSB PDB site
Description: Solution structure of the human homodimeric dna repair protein XPF
Class: DNA repair, hydrolase
Keywords: nmr spectroscopy, DNA REPAIR, HYDROLASE
Deposited on 2005-08-17, released 2006-10-03
The last revision prior to the SCOPe 2.06 freeze date was dated 2008-08-05, with a file datestamp of 2009-02-19.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.04 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: DNA repair endonuclease XPF
    Species: Homo sapiens [TaxId:9606]
    Gene: ERCC4, ERCC11, XPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92889
      • initiating methionine (0)
    Domains in SCOPe 2.06: d2aq0a_
  • Chain 'B':
    Compound: DNA repair endonuclease XPF
    Species: Homo sapiens [TaxId:9606]
    Gene: ERCC4, ERCC11, XPF
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q92889 (1-83)
      • initiating methionine (0)
    Domains in SCOPe 2.06: d2aq0b_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aq0A (A:)
    mdsetlpesekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaa
    nakqlydfihtsfaevvskgkgkk
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aq0B (B:)
    mdsetlpesekynpgpqdfllkmpgvnakncrslmhhvkniaelaalsqdeltsilgnaa
    nakqlydfihtsfaevvskgkgkk