PDB entry 2aih

View 2aih on RCSB PDB site
Description: 1H-NMR solution structure of a trypsin/chymotrypsin Bowman-Birk inhibitor from Lens culinaris.
Class: hydrolase
Keywords: trypsin/chymotrypsin Bowman-Birk inhibitor, two-strands beta-sheet, HYDROLASE
Deposited on 2005-07-29, released 2006-08-01
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Bowman-Birk type protease inhibitor, LCTI
    Species: Lens culinaris [TaxId:3864]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.04: d2aiha_
  • Heterogens: CL

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >2aihA (A:)
    gddvksaccdtclctrsqpptcrcvdvreschsacdkcvcaysnppqcqcydthkfcyka
    chnseie