Lineage for d2aiha_ (2aih A:)

  1. Root: SCOPe 2.04
  2. 1700111Class g: Small proteins [56992] (91 folds)
  3. 1700389Fold g.3: Knottins (small inhibitors, toxins, lectins) [57015] (19 superfamilies)
    disulfide-bound fold; contains beta-hairpin with two adjacent disulfides
  4. 1701956Superfamily g.3.13: Bowman-Birk inhibitor, BBI [57247] (2 families) (S)
  5. 1701995Family g.3.13.0: automated matches [254212] (1 protein)
    not a true family
  6. 1701996Protein automated matches [254478] (2 species)
    not a true protein
  7. 1701997Species Common lentil (Lens culinaris) [TaxId:3864] [255031] (1 PDB entry)
  8. 1701998Domain d2aiha_: 2aih A: [241234]
    automated match to d1bbia_
    complexed with cl

Details for d2aiha_

PDB Entry: 2aih (more details)

PDB Description: 1h-nmr solution structure of a trypsin/chymotrypsin bowman-birk inhibitor from lens culinaris.
PDB Compounds: (A:) Bowman-Birk type protease inhibitor, LCTI

SCOPe Domain Sequences for d2aiha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aiha_ g.3.13.0 (A:) automated matches {Common lentil (Lens culinaris) [TaxId: 3864]}
gddvksaccdtclctrsqpptcrcvdvreschsacdkcvcaysnppqcqcydthkfcyka
chnseie

SCOPe Domain Coordinates for d2aiha_:

Click to download the PDB-style file with coordinates for d2aiha_.
(The format of our PDB-style files is described here.)

Timeline for d2aiha_: