PDB entry 2aaw

View 2aaw on RCSB PDB site
Description: Studies on ligand binding and enzyme inhibition of Plasmodium falciparum glutathione S-transferase
Class: transferase
Keywords: malarial, plasmodium falciparum, glutathione S-transferase, S-hexylglutathione, TRANSFERASE
Deposited on 2005-07-14, released 2006-01-10
The last revision prior to the SCOPe 2.07 freeze date was dated 2015-06-10, with a file datestamp of 2015-06-05.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: N/A
AEROSPACI score: 0.23 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: glutathione s-transferase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • GB AAL25087 (12-221)
      • initiating methionine (11)
    Domains in SCOPe 2.07: d2aawa1, d2aawa2
  • Chain 'C':
    Compound: glutathione s-transferase
    Species: Plasmodium falciparum [TaxId:5833]
    Database cross-references and differences (RAF-indexed):
    • GB AAL25087 (12-221)
      • initiating methionine (11)
    Domains in SCOPe 2.07: d2aawc1, d2aawc2
  • Heterogens: GTX, P33, DTL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >2aawA (A:)
    rgshhhhhhgsmgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfk
    kekdtpfeqvpilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihyk
    fnntnlfkqnettflnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnly
    ddietkypsslknfpllkahnefisnlpniknyitnrkesvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aawA (A:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqne
    ttflnedlpkwsgyfekllkknhkyyfvgnnltyadlavfnlyddietkypsslknfpll
    kahnefisnlpniknyitnrkesvy
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >2aawC (C:)
    rgshhhhhhgsmgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfk
    kekdtpfeqvpilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihyk
    fnntnlfkqnettflnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnly
    ddietkypsslknfpllkahnefisnlpniknyitnrkesvy
    

    Sequence, based on observed residues (ATOM records): (download)
    >2aawC (C:)
    mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
    ilqigdlilaqsqaivrylskkynicgeselnefyadmifcgvqdihykfnntnlfkqne
    ttflnedlpkwsgyfekllkknhtnnnndkyyfvgnnltyadlavfnlyddietkypssl
    knfpllkahnefisnlpniknyitnrkesvy