Lineage for d2aawc1 (2aaw C:86-211)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2712830Fold a.45: GST C-terminal domain-like [47615] (1 superfamily)
    core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix
  4. 2712831Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) (S)
    this domains follows the thioredoxin-like N-terminal domain
  5. 2712832Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins)
  6. 2713549Protein automated matches [226848] (14 species)
    not a true protein
  7. 2713701Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [225818] (3 PDB entries)
  8. 2713707Domain d2aawc1: 2aaw C:86-211 [126498]
    Other proteins in same PDB: d2aawa2, d2aawc2
    automated match to d1okta1
    complexed with dtl, gtx, p33

Details for d2aawc1

PDB Entry: 2aaw (more details), 2.4 Å

PDB Description: studies on ligand binding and enzyme inhibition of plasmodium falciparum glutathione s-transferase
PDB Compounds: (C:) glutathione s-transferase

SCOPe Domain Sequences for d2aawc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aawc1 a.45.1.1 (C:86-211) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn
nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn
rkesvy

SCOPe Domain Coordinates for d2aawc1:

Click to download the PDB-style file with coordinates for d2aawc1.
(The format of our PDB-style files is described here.)

Timeline for d2aawc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aawc2