![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.45: GST C-terminal domain-like [47615] (1 superfamily) core: 4 helices; bundle, closed, left-handed twist; right-handed superhelix |
![]() | Superfamily a.45.1: GST C-terminal domain-like [47616] (3 families) ![]() this domains follows the thioredoxin-like N-terminal domain |
![]() | Family a.45.1.1: Glutathione S-transferase (GST), C-terminal domain [47617] (19 proteins) |
![]() | Protein automated matches [226848] (14 species) not a true protein |
![]() | Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [225818] (3 PDB entries) |
![]() | Domain d2aawc1: 2aaw C:86-211 [126498] Other proteins in same PDB: d2aawa2, d2aawc2 automated match to d1okta1 complexed with dtl, gtx, p33 |
PDB Entry: 2aaw (more details), 2.4 Å
SCOPe Domain Sequences for d2aawc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d2aawc1 a.45.1.1 (C:86-211) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} cgeselnefyadmifcgvqdihykfnntnlfkqnettflnedlpkwsgyfekllkknhtn nnndkyyfvgnnltyadlavfnlyddietkypsslknfpllkahnefisnlpniknyitn rkesvy
Timeline for d2aawc1: