Lineage for d2aawa2 (2aaw A:1-85)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2876126Fold c.47: Thioredoxin fold [52832] (2 superfamilies)
    core: 3 layers, a/b/a; mixed beta-sheet of 4 strands, order 4312; strand 3 is antiparallel to the rest
  4. 2876127Superfamily c.47.1: Thioredoxin-like [52833] (24 families) (S)
  5. 2876589Family c.47.1.5: Glutathione S-transferase (GST), N-terminal domain [52862] (19 proteins)
  6. 2877295Protein automated matches [227019] (4 species)
    not a true protein
  7. 2877308Species Malaria parasite (Plasmodium falciparum) [TaxId:5833] [225817] (3 PDB entries)
  8. 2877313Domain d2aawa2: 2aaw A:1-85 [126497]
    Other proteins in same PDB: d2aawa1, d2aawc1
    automated match to d1okta2
    complexed with dtl, gtx, p33

Details for d2aawa2

PDB Entry: 2aaw (more details), 2.4 Å

PDB Description: studies on ligand binding and enzyme inhibition of plasmodium falciparum glutathione s-transferase
PDB Compounds: (A:) glutathione s-transferase

SCOPe Domain Sequences for d2aawa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2aawa2 c.47.1.5 (A:1-85) automated matches {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]}
mgdnivlyyfdargkaelirlifaylgieytdkrfgvngdafvefknfkkekdtpfeqvp
ilqigdlilaqsqaivrylskkyni

SCOPe Domain Coordinates for d2aawa2:

Click to download the PDB-style file with coordinates for d2aawa2.
(The format of our PDB-style files is described here.)

Timeline for d2aawa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d2aawa1