PDB entry 1zkc

View 1zkc on RCSB PDB site
Description: Crystal Structure of the cyclophiln_RING domain of human peptidylprolyl isomerase (cyclophilin)-like 2 isoform b
Class: isomerase
Keywords: CIS-TRANS ISOMERIZATION, peptidylprolyl isomerase, protein-folding, STRUCTURAL GENOMICS CONSORTIUM, SGC
Deposited on 2005-05-02, released 2005-08-16
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 1.65 Å
R-factor: 0.158
AEROSPACI score: 0.6 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Peptidyl-prolyl cis-trans isomerase like 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13356 (19-196)
      • cloning artifact (10-18)
    Domains in SCOPe 2.07: d1zkca1, d1zkca2
  • Chain 'B':
    Compound: Peptidyl-prolyl cis-trans isomerase like 2
    Species: Homo sapiens [TaxId:9606]
    Gene: PPIL2
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13356 (19-196)
      • cloning artifact (12-18)
    Domains in SCOPe 2.07: d1zkcb2, d1zkcb3
  • Heterogens: BME, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1zkcA (A:)
    mgsshhhhhhssglvprgsgyvrlhtnkgdlnlelhcdltpktcenfirlckkhyydgti
    fhrsirnfviqggdptgtgtggesywgkpfkdefrpnlshtgrgilsmansgpnsnrsqf
    fitfrscayldkkhtifgrvvggfdvltamenvesdpktdrpkeeiridattvfvdpyee
    adaqiaqerktqlkvap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkcA (A:)
    ssglvprgsgyvrlhtnkgdlnlelhcdltpktcenfirlckkhyydgtifhrsirnfvi
    qggdptgtgtggesywgkpfkdefrpnlshtgrgilsmansgpnsnrsqffitfrscayl
    dkkhtifgrvvggfdvltamenvesdpktdrpkeeiridattvfvdpyeeadaqiaqerk
    tqlkvap
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1zkcB (B:)
    mgsshhhhhhssglvprgsgyvrlhtnkgdlnlelhcdltpktcenfirlckkhyydgti
    fhrsirnfviqggdptgtgtggesywgkpfkdefrpnlshtgrgilsmansgpnsnrsqf
    fitfrscayldkkhtifgrvvggfdvltamenvesdpktdrpkeeiridattvfvdpyee
    adaqiaqerktqlkvap
    

    Sequence, based on observed residues (ATOM records): (download)
    >1zkcB (B:)
    glvprgsgyvrlhtnkgdlnlelhcdltpktcenfirlckkhyydgtifhrsirnfviqg
    gdptgtgtggesywgkpfkdefrpnlshtgrgilsmansgpnsnrsqffitfrscayldk
    khtifgrvvggfdvltamenvesdpktdrpkeeiridattvfvdpyeeadaqiaqerktq
    lkvap