Lineage for d1zkcb2 (1zkc B:280-457)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2806645Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2806646Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2806647Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2806985Protein Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain [141505] (1 species)
  7. 2806986Species Human (Homo sapiens) [TaxId:9606] [141506] (1 PDB entry)
    Uniprot Q13356 280-457
  8. 2806988Domain d1zkcb2: 1zkc B:280-457 [125183]
    Other proteins in same PDB: d1zkca2, d1zkcb3
    automated match to d1zkca1
    complexed with bme

Details for d1zkcb2

PDB Entry: 1zkc (more details), 1.65 Å

PDB Description: crystal structure of the cyclophiln_ring domain of human peptidylprolyl isomerase (cyclophilin)-like 2 isoform b
PDB Compounds: (B:) Peptidyl-prolyl cis-trans isomerase like 2

SCOPe Domain Sequences for d1zkcb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkcb2 b.62.1.1 (B:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]}
gyvrlhtnkgdlnlelhcdltpktcenfirlckkhyydgtifhrsirnfviqggdptgtg
tggesywgkpfkdefrpnlshtgrgilsmansgpnsnrsqffitfrscayldkkhtifgr
vvggfdvltamenvesdpktdrpkeeiridattvfvdpyeeadaqiaqerktqlkvap

SCOPe Domain Coordinates for d1zkcb2:

Click to download the PDB-style file with coordinates for d1zkcb2.
(The format of our PDB-style files is described here.)

Timeline for d1zkcb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zkcb3