![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.62: Cyclophilin-like [50890] (1 superfamily) barrel, closed; n=8, S=10; complex topology |
![]() | Superfamily b.62.1: Cyclophilin-like [50891] (5 families) ![]() |
![]() | Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins) automatically mapped to Pfam PF00160 |
![]() | Protein Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain [141505] (1 species) |
![]() | Species Human (Homo sapiens) [TaxId:9606] [141506] (1 PDB entry) Uniprot Q13356 280-457 |
![]() | Domain d1zkcb2: 1zkc B:280-457 [125183] Other proteins in same PDB: d1zkca2, d1zkcb3 automated match to d1zkca1 complexed with bme |
PDB Entry: 1zkc (more details), 1.65 Å
SCOPe Domain Sequences for d1zkcb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1zkcb2 b.62.1.1 (B:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]} gyvrlhtnkgdlnlelhcdltpktcenfirlckkhyydgtifhrsirnfviqggdptgtg tggesywgkpfkdefrpnlshtgrgilsmansgpnsnrsqffitfrscayldkkhtifgr vvggfdvltamenvesdpktdrpkeeiridattvfvdpyeeadaqiaqerktqlkvap
Timeline for d1zkcb2: