Lineage for d1zkca1 (1zkc A:280-457)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2397365Fold b.62: Cyclophilin-like [50890] (1 superfamily)
    barrel, closed; n=8, S=10; complex topology
  4. 2397366Superfamily b.62.1: Cyclophilin-like [50891] (5 families) (S)
  5. 2397367Family b.62.1.1: Cyclophilin (peptidylprolyl isomerase) [50892] (13 proteins)
    automatically mapped to Pfam PF00160
  6. 2397668Protein Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain [141505] (1 species)
  7. 2397669Species Human (Homo sapiens) [TaxId:9606] [141506] (1 PDB entry)
    Uniprot Q13356 280-457
  8. 2397670Domain d1zkca1: 1zkc A:280-457 [125182]
    Other proteins in same PDB: d1zkca2, d1zkcb3
    includes extra C-terminal helix
    complexed with bme

Details for d1zkca1

PDB Entry: 1zkc (more details), 1.65 Å

PDB Description: crystal structure of the cyclophiln_ring domain of human peptidylprolyl isomerase (cyclophilin)-like 2 isoform b
PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase like 2

SCOPe Domain Sequences for d1zkca1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1zkca1 b.62.1.1 (A:280-457) Peptidyl-prolyl cis-trans isomerase-like 2, Cyclophilin-60, PPI domain {Human (Homo sapiens) [TaxId: 9606]}
gyvrlhtnkgdlnlelhcdltpktcenfirlckkhyydgtifhrsirnfviqggdptgtg
tggesywgkpfkdefrpnlshtgrgilsmansgpnsnrsqffitfrscayldkkhtifgr
vvggfdvltamenvesdpktdrpkeeiridattvfvdpyeeadaqiaqerktqlkvap

SCOPe Domain Coordinates for d1zkca1:

Click to download the PDB-style file with coordinates for d1zkca1.
(The format of our PDB-style files is described here.)

Timeline for d1zkca1:

View in 3D
Domains from same chain:
(mouse over for more information)
d1zkca2