PDB entry 1z61

View 1z61 on RCSB PDB site
Description: Solution structure of the functional domain of phi29 replication organizer p16.7C
Class: DNA binding protein
Keywords: phi-29 replication, Nonspecific DNA binding protein, Helical dimer
Deposited on 2005-03-21, released 2005-04-05
The last revision prior to the SCOPe 2.07 freeze date was dated 2005-04-19, with a file datestamp of 2007-04-25.
Experiment type: NMR25
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.05 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: early protein gp16.7
  Species: Bacteriophage phi-29
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16517 (2-69)
    • cloning artifact (0-1)
  Domains in SCOPe 2.07: d1z61a1, d1z61a2
• Chain 'B':
  Compound: early protein gp16.7
  Species: Bacteriophage phi-29
  Database cross-references and differences (RAF-indexed):
  • Uniprot P16517 (2-69)
    • cloning artifact (0-1)
  Domains in SCOPe 2.07: d1z61b1, d1z61b2

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z61A (A:)
  hmdktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklen
  qkklyrgslk
  

  
  
• Chain 'B':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1z61B (B:)
  hmdktvnlsacevavldlyeqsniripsdiiedlvnqrlqseqevlnyietqrtywklen
  qkklyrgslk