PDB entry 1ytz

View 1ytz on RCSB PDB site
Description: Crystal structure of skeletal muscle troponin in the Ca2+-activated state
Class: contractile protein
Keywords: troponin, muscle, thin filament, actin binding, calcium, CONTRACTILE PROTEIN
Deposited on 2005-02-11, released 2005-04-12
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 3 Å
R-factor: 0.289
AEROSPACI score: 0.14 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'C':
    Compound: troponin c
    Species: Gallus gallus [TaxId:9031]
    Gene: TNNC2
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ytzc_
  • Chain 'I':
    Compound: troponin I
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P68246
      • engineered (47)
      • engineered (63)
    Domains in SCOPe 2.07: d1ytzi1
  • Chain 'T':
    Compound: Troponin T
    Species: Gallus gallus [TaxId:9031]
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.07: d1ytzt1
  • Heterogens: CA, DR6, HOH

PDB Chain Sequences:

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1ytzC (C:)
    asmtdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeelda
    iieevdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelge
    ilratgehvteediedlmkdsdknndgridfdeflkmmegvq
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytzC (C:)
    tdqqaearaflseemiaefkaafdmfdadgggdistkelgtvmrmlgqnptkeeldaiie
    evdedgsgtidfeeflvmmvrqmkedakgkseeelancfrifdknadgfidieelgeilr
    atgehvteediedlmkdsdknndgridfdeflkmmegvq
    

  • Chain 'I':
    Sequence, based on SEQRES records: (download)
    >1ytzI (I:)
    sdeekkrraatarrqhlksamlqlavteiekeaaakevekqnylaehspplslpgsmqel
    qelskklhakidsvdeerydtevklqktnkeledlsqklfdlrgkfkrpplrrvrmsada
    mlrallgskhkvnmdlranlkqvkkedtekekdlrdvgdwrknieeksgmegrkkmfeag
    es
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytzI (I:)
    eekkrraatarrqhlksamlqlavteiekeaaakevekqnylaehspplslpgsmqelqe
    lskklhakidsvdeerydtevklqktnkeledlsqklfdlrgkfkrpplrrvrmsadaml
    rallgskhkvnmdlranlkqv
    

  • Chain 'T':
    Sequence, based on SEQRES records: (download)
    >1ytzT (T:)
    mgasyssylakadqkrgkkqtaretkkkvlaerrkplnidhlnedklrdkakelwdwlyq
    lqtekydfaeqikrkkyeivtlrnridqaqkhskkagakgkvggrwk
    

    Sequence, based on observed residues (ATOM records): (download)
    >1ytzT (T:)
    syssylakadqkrgkkqtaretkkkvlaerrkplnidhlnedklrdkakelwdwlyqlqt
    ekydfaeqikrkkyeivtlrnridqaqkhs