Lineage for d1ytzi1 (1ytz I:3-143)

  1. Root: SCOPe 2.08
  2. 3039230Class h: Coiled coil proteins [57942] (7 folds)
  3. 3039231Fold h.1: Parallel coiled-coil [57943] (41 superfamilies)
    this is not a true fold; includes oligomers of shorter identical helices
  4. 3040519Superfamily h.1.25: Troponin coil-coiled subunits [90250] (2 families) (S)
    form heterodimeric coiled coil
  5. 3040531Family h.1.25.2: Troponin I [90254] (1 protein)
  6. 3040532Protein Troponin I [90255] (2 species)
  7. 3040533Species Chicken (Gallus gallus) [TaxId:9031] [144263] (2 PDB entries)
    Uniprot P68246 3-118! Uniprot P68246 3-143
  8. 3040534Domain d1ytzi1: 1ytz I:3-143 [124023]
    Other proteins in same PDB: d1ytzc_, d1ytzt1
    complexed with ca, dr6

Details for d1ytzi1

PDB Entry: 1ytz (more details), 3 Å

PDB Description: crystal structure of skeletal muscle troponin in the ca2+-activated state
PDB Compounds: (I:) troponin I

SCOPe Domain Sequences for d1ytzi1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ytzi1 h.1.25.2 (I:3-143) Troponin I {Chicken (Gallus gallus) [TaxId: 9031]}
eekkrraatarrqhlksamlqlavteiekeaaakevekqnylaehspplslpgsmqelqe
lskklhakidsvdeerydtevklqktnkeledlsqklfdlrgkfkrpplrrvrmsadaml
rallgskhkvnmdlranlkqv

SCOPe Domain Coordinates for d1ytzi1:

Click to download the PDB-style file with coordinates for d1ytzi1.
(The format of our PDB-style files is described here.)

Timeline for d1ytzi1: