PDB entry 1yta

View 1yta on RCSB PDB site
Description: Crystal Structure of Oligoribonuclease, the lone essential exoribonuclease in Escherichia coli
Class: hydrolase,translation
Keywords: RNase; exoribonuclease; ribonuclease; exonuclease; nuclease; hydrolase; mRNA decay, HYDROLASE,TRANSLATION
Deposited on 2005-02-10, released 2006-02-14
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.2 Å
R-factor: 0.209
AEROSPACI score: 0.39 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Oligoribonuclease
    Species: Escherichia coli [TaxId:562]
    Gene: ORN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39287 (0-179)
      • modified residue (13)
      • modified residue (56)
      • modified residue (78)
      • modified residue (118)
      • modified residue (159)
    Domains in SCOPe 2.07: d1ytaa1
  • Chain 'B':
    Compound: Oligoribonuclease
    Species: Escherichia coli [TaxId:562]
    Gene: ORN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39287 (0-179)
      • modified residue (13)
      • modified residue (56)
      • modified residue (78)
      • modified residue (118)
      • modified residue (159)
    Domains in SCOPe 2.07: d1ytab_
  • Chain 'C':
    Compound: Oligoribonuclease
    Species: Escherichia coli [TaxId:562]
    Gene: ORN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39287 (0-179)
      • modified residue (13)
      • modified residue (56)
      • modified residue (78)
      • modified residue (118)
      • modified residue (159)
    Domains in SCOPe 2.07: d1ytac_
  • Chain 'D':
    Compound: Oligoribonuclease
    Species: Escherichia coli [TaxId:562]
    Gene: ORN
    Database cross-references and differences (RAF-indexed):
    • Uniprot P39287 (0-179)
      • modified residue (13)
      • modified residue (56)
      • modified residue (78)
      • modified residue (118)
      • modified residue (159)
    Domains in SCOPe 2.07: d1ytad_
  • Heterogens: FLC, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytaA (A:)
    sanennliwidlemtgldperdriieiatlvtdanlnilaegptiavhqsdeqlalmddw
    nvrthtasglvervkastmgdreaelatleflkqwvpagkspicgnsigqdrrflfkymp
    eleayfhyryldvstlkelarrwkpeildgftkqgthqamddiresvaelayyrehfikl
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytaB (B:)
    sanennliwidlemtgldperdriieiatlvtdanlnilaegptiavhqsdeqlalmddw
    nvrthtasglvervkastmgdreaelatleflkqwvpagkspicgnsigqdrrflfkymp
    eleayfhyryldvstlkelarrwkpeildgftkqgthqamddiresvaelayyrehfikl
    

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytaC (C:)
    sanennliwidlemtgldperdriieiatlvtdanlnilaegptiavhqsdeqlalmddw
    nvrthtasglvervkastmgdreaelatleflkqwvpagkspicgnsigqdrrflfkymp
    eleayfhyryldvstlkelarrwkpeildgftkqgthqamddiresvaelayyrehfikl
    

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1ytaD (D:)
    sanennliwidlemtgldperdriieiatlvtdanlnilaegptiavhqsdeqlalmddw
    nvrthtasglvervkastmgdreaelatleflkqwvpagkspicgnsigqdrrflfkymp
    eleayfhyryldvstlkelarrwkpeildgftkqgthqamddiresvaelayyrehfikl