SCOPe 2.07: Domain d1ytaa1: 1yta A:1-180

Lineage for d1ytaa1 (1yta A:1-180)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.3: Ribonuclease H-like [53098] (16 families)
   consists of one domain of this fold

5. Family c.55.3.5: DnaQ-like 3'-5' exonuclease [53118] (17 proteins)
   contains Pfam PF00929

6. Protein Oligoribonuclease [89719] (2 species)

7. Species Escherichia coli [TaxId:562] [142492] (2 PDB entries)
   Uniprot P0A784 1-180

8. Domain d1ytaa1: 1yta A:1-180 [124002]
   complexed with flc

Details for d1ytaa1

PDB Entry: 1yta, 2.2 Å

PDB Description: Crystal Structure of Oligoribonuclease, the lone essential exoribonuclease in Escherichia coli

PDB Compounds: (A:) Oligoribonuclease

SCOPe Domain Sequences for d1ytaa1:

Sequence; same for both SEQRES and ATOM records:

>d1ytaa1 c.55.3.5 (A:1-180) Oligoribonuclease {Escherichia coli [TaxId: 562]}
sanennliwidlemtgldperdriieiatlvtdanlnilaegptiavhqsdeqlalmddw
nvrthtasglvervkastmgdreaelatleflkqwvpagkspicgnsigqdrrflfkymp
eleayfhyryldvstlkelarrwkpeildgftkqgthqamddiresvaelayyrehfikl

Timeline for d1ytaa1:

• d1ytaa1 first appeared in SCOP 1.73
  
• d1ytaa1 appears in SCOPe 2.06
  
• d1ytaa1 appears in the current release, SCOPe 2.08