PDB entry 1yr0

View 1yr0 on RCSB PDB site
Description: Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
Class: transferase
Keywords: Structural Genomics, Protein Structure Initiative, NYSGXRC, T1682, AGR_C_1654, phosphinothricin acetyltransferase, PSI, New York SGX Research Center for Structural Genomics, TRANSFERASE
Deposited on 2005-02-02, released 2005-02-15
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-11-16, with a file datestamp of 2011-11-11.
Experiment type: XRAY
Resolution: 2 Å
R-factor: 0.192
AEROSPACI score: 0.45 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: phosphinothricin acetyltransferase
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: AGR_C_1654
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UGX8
      • modified residue (18)
      • modified residue (104)
      • modified residue (161)
    Domains in SCOPe 2.07: d1yr0a1
  • Chain 'B':
    Compound: phosphinothricin acetyltransferase
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: AGR_C_1654
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UGX8
      • modified residue (18)
      • modified residue (104)
      • modified residue (161)
    Domains in SCOPe 2.07: d1yr0b_
  • Chain 'C':
    Compound: phosphinothricin acetyltransferase
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: AGR_C_1654
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UGX8
      • modified residue (18)
      • modified residue (104)
      • modified residue (161)
    Domains in SCOPe 2.07: d1yr0c_
  • Chain 'D':
    Compound: phosphinothricin acetyltransferase
    Species: Agrobacterium tumefaciens str. [TaxId:176299]
    Gene: AGR_C_1654
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8UGX8
      • modified residue (18)
      • modified residue (104)
      • modified residue (161)
    Domains in SCOPe 2.07: d1yr0d_
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yr0A (A:)
    mslsvelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpviva
    ildgkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvl
    iaaieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelklgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yr0A (A:)
    svelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaild
    gkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaa
    ieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelkl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yr0B (B:)
    mslsvelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpviva
    ildgkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvl
    iaaieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelklgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yr0B (B:)
    svelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaild
    gkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaa
    ieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelkl
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1yr0C (C:)
    mslsvelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpviva
    ildgkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvl
    iaaieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelklgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yr0C (C:)
    svelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaild
    gkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaa
    ieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelkl
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1yr0D (D:)
    mslsvelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpviva
    ildgkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvl
    iaaieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelklgeghhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yr0D (D:)
    svelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaild
    gkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaa
    ieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelkl