Lineage for d1yr0d_ (1yr0 D:)

  1. Root: SCOPe 2.07
  2. 2494617Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2533209Fold d.108: Acyl-CoA N-acyltransferases (Nat) [55728] (1 superfamily)
    3 layers: a/b/a; contains mixed beta-sheet
  4. 2533210Superfamily d.108.1: Acyl-CoA N-acyltransferases (Nat) [55729] (11 families) (S)
  5. 2533769Family d.108.1.0: automated matches [191308] (1 protein)
    not a true family
  6. 2533770Protein automated matches [190038] (46 species)
    not a true protein
  7. 2533786Species Agrobacterium tumefaciens [TaxId:176299] [186886] (1 PDB entry)
  8. 2533789Domain d1yr0d_: 1yr0 D: [123908]
    Other proteins in same PDB: d1yr0a1
    automated match to d1vhsa_
    complexed with so4

Details for d1yr0d_

PDB Entry: 1yr0 (more details), 2 Å

PDB Description: Crystal structure of phosphinothricin acetyltransferase from agrobacterium tumefaciens
PDB Compounds: (D:) phosphinothricin acetyltransferase

SCOPe Domain Sequences for d1yr0d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1yr0d_ d.108.1.0 (D:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
svelrdatvddlsgimeiyndavvnttaiwnevvvdlenrkdwfaartsrgfpvivaild
gkvagyasygdwrafdgyrhtrehsvyvhkdarghgigkrlmqalidhaggndvhvliaa
ieaentasirlheslgfrvvgrfsevgtkfgrwldltcmelkl

SCOPe Domain Coordinates for d1yr0d_:

Click to download the PDB-style file with coordinates for d1yr0d_.
(The format of our PDB-style files is described here.)

Timeline for d1yr0d_: