PDB entry 1yo4

View 1yo4 on RCSB PDB site
Description: Solution Structure of the SARS Coronavirus ORF 7a coded X4 protein
Class: viral protein
Keywords: beta-sandwich, immunoglobulin-like domain, VIRAL PROTEIN
Deposited on 2005-01-26, released 2006-01-17
The last revision prior to the SCOPe 2.04 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

• Chain 'A':
  Compound: Hypothetical protein X4
  Species: SARS coronavirus [TaxId:227859]
  Database cross-references and differences (RAF-indexed):
  • Uniprot P59635 (2-85)
    • cloning artifact (0-1)
    • cloning artifact (86)
  Domains in SCOPe 2.04: d1yo4a_

PDB Chain Sequences:

• Chain 'A':
  Sequence; same for both SEQRES and ATOM records: (download)
  

  >1yo4A (A:)
  gpelyhyqecvrgttvllkepcpsgtyegnspfhpladnkfaltctsthfafacadgtrh
  tyqlrarsvspklfirqeevqqelysr