SCOPe 2.04: Domain d1yo4a_: 1yo4 A:

Lineage for d1yo4a_ (1yo4 A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.24: Accessory protein X4 (ORF8, ORF7a) [117066] (1 family)
   automatically mapped to Pfam PF08779

5. Family b.1.24.1: Accessory protein X4 (ORF8, ORF7a) [117067] (2 proteins)

6. Protein automated matches [254460] (1 species)
   not a true protein

7. Species SARS coronavirus [TaxId:227859] [254986] (1 PDB entry)

8. Domain d1yo4a_: 1yo4 A: [241048]
   automated match to d1xaka_

Details for d1yo4a_

PDB Entry: 1yo4

PDB Description: solution structure of the sars coronavirus orf 7a coded x4 protein

PDB Compounds: (A:) Hypothetical protein X4

SCOPe Domain Sequences for d1yo4a_:

Sequence; same for both SEQRES and ATOM records:

>d1yo4a_ b.1.24.1 (A:) automated matches {SARS coronavirus [TaxId: 227859]}
gpelyhyqecvrgttvllkepcpsgtyegnspfhpladnkfaltctsthfafacadgtrh
tyqlrarsvspklfirqeevqqelysr

Timeline for d1yo4a_:

• d1yo4a_ is new in SCOPe 2.04-stable
  
• d1yo4a_ appears in SCOPe 2.05
  
• d1yo4a_ appears in the current release, SCOPe 2.08, called d1yo4a1