PDB entry 1yfs

View 1yfs on RCSB PDB site
Description: The crystal structure of alanyl-tRNA synthetase in complex with L-alanine
Class: ligase
Keywords: alpha-beta fold, helix-loop-helix motif, amino acid binding, ligase
Deposited on 2005-01-03, released 2005-01-25
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: XRAY
Resolution: 2.08 Å
R-factor: 0.189
AEROSPACI score: 0.41 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Alanyl-tRNA synthetase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: alaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67323 (Start-453)
      • cloning artifact (454-457)
    Domains in SCOPe 2.07: d1yfsa1, d1yfsa2, d1yfsa3
  • Chain 'B':
    Compound: Alanyl-tRNA synthetase
    Species: Aquifex aeolicus [TaxId:63363]
    Gene: alaS
    Database cross-references and differences (RAF-indexed):
    • Uniprot O67323 (Start-453)
      • cloning artifact (454-457)
    Domains in SCOPe 2.07: d1yfsb1, d1yfsb2, d1yfsb3
  • Heterogens: ALA, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1yfsA (A:)
    mslsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpyk
    ratscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlk
    lpkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdr
    geeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeid
    iifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirril
    rramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkag
    meyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqcelee
    qrerarkhfkveakkvkpvyshlkelgktsafvgaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfsA (A:)
    slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
    atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
    pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
    eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeidi
    ifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirrilr
    ramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkagm
    eyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqceleeq
    rerarkhpvyshlkelgktsafvgaaal
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1yfsB (B:)
    mslsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpyk
    ratscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlk
    lpkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdr
    geeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeid
    iifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirril
    rramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkag
    meyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqcelee
    qrerarkhfkveakkvkpvyshlkelgktsafvgaaalehhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1yfsB (B:)
    slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
    atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
    pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
    eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnfeidi
    ifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvirrilr
    ramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktlkagm
    eyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqceleeq
    rerarkhpvyshlkelgktsafvgaaal