Lineage for d1yfsa1 (1yfs A:237-453)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736398Fold a.203: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101352] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
  4. 2736399Superfamily a.203.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101353] (1 family) (S)
  5. 2736400Family a.203.1.1: Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101354] (1 protein)
  6. 2736401Protein Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) [101355] (1 species)
  7. 2736402Species Aquifex aeolicus [TaxId:63363] [101356] (6 PDB entries)
  8. 2736403Domain d1yfsa1: 1yfs A:237-453 [123088]
    Other proteins in same PDB: d1yfsa2, d1yfsa3, d1yfsb2, d1yfsb3
    automated match to d1riqa1
    protein/RNA complex; complexed with ala

Details for d1yfsa1

PDB Entry: 1yfs (more details), 2.08 Å

PDB Description: The crystal structure of alanyl-tRNA synthetase in complex with L-alanine
PDB Compounds: (A:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d1yfsa1:

Sequence, based on SEQRES records: (download)

>d1yfsa1 a.203.1.1 (A:237-453) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhfkveakkvkpvyshlkelgktsafvg

Sequence, based on observed residues (ATOM records): (download)

>d1yfsa1 a.203.1.1 (A:237-453) Putative anticodon-binding domain of alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
eidiifpliqfgeevsgkkygekfetdvalrviadhlraitfaisdgvipsnegrgyvir
rilrramrfgyklgienpflykgvdlvvdimkepypelelsrefvkgivkgeekrfiktl
kagmeyiqeviqkaleegrktlsgkevftaydtygfpvdlideiarekglgidlegfqce
leeqrerarkhpvyshlkelgktsafvg

SCOPe Domain Coordinates for d1yfsa1:

Click to download the PDB-style file with coordinates for d1yfsa1.
(The format of our PDB-style files is described here.)

Timeline for d1yfsa1: