SCOPe 2.08: Domain d1yfsb2: 1yfs B:1-236

Lineage for d1yfsb2 (1yfs B:1-236)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.104: Class II aaRS and biotin synthetases [55680] (1 superfamily)
   contains large mixed beta-sheet

4. Superfamily d.104.1: Class II aaRS and biotin synthetases [55681] (5 families)

5. Family d.104.1.1: Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain [55682] (16 proteins)

6. Protein Alanyl-tRNA synthetase (AlaRS) [103155] (1 species)

7. Species Aquifex aeolicus [TaxId:63363] [103156] (6 PDB entries)

8. Domain d1yfsb2: 1yfs B:1-236 [123091]
   Other proteins in same PDB: d1yfsa1, d1yfsa3, d1yfsb1, d1yfsb3
   automated match to d1riqa2
   protein/RNA complex; complexed with ala

Details for d1yfsb2

PDB Entry: 1yfs, 2.08 Å

PDB Description: The crystal structure of alanyl-tRNA synthetase in complex with L-alanine

PDB Compounds: (B:) Alanyl-tRNA synthetase

SCOPe Domain Sequences for d1yfsb2:

Sequence; same for both SEQRES and ATOM records:

>d1yfsb2 d.104.1.1 (B:1-236) Alanyl-tRNA synthetase (AlaRS) {Aquifex aeolicus [TaxId: 63363]}
slsaheirelflsffekkghtrvksaplvpendptllfvnagmvpfknvflglekrpykr
atscqkclrvsgkhndleqvgytsrhhtffemlgnfsfgdyfkkeaieyawefvtevlkl
pkeklyvsvykddeeayriwnehigipseriwrlgeednfwqmgdvgpcgpsseiyvdrg
eeyegderyleiwnlvfmqynrdengvltplphpnidtgmgleriasvlqgknsnf

Timeline for d1yfsb2:

• d1yfsb2 first appeared in SCOP 1.73
  
• d1yfsb2 appears in SCOPe 2.07