PDB entry 1y9i

View 1y9i on RCSB PDB site
Description: Crystal structure of low temperature requirement C protein from Listeria monocytogenes
Class: structural genomics, unknown function
Keywords: Structural Genomics, Protein Structure Initiative, PSI, New York SGX Research Center for Structural Genomics, NYSGXRC, Helical bundle, Tetramer, Putative PGPA, UNKNOWN FUNCTION
Deposited on 2004-12-15, released 2004-12-28
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-10-11, with a file datestamp of 2017-10-06.
Experiment type: XRAY
Resolution: 1.8 Å
R-factor: N/A
AEROSPACI score: 0.37 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: low temperature requirement C protein
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZIM5
      • modified residue (73)
    Domains in SCOPe 2.07: d1y9ia_
  • Chain 'B':
    Compound: low temperature requirement C protein
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZIM5
      • modified residue (73)
    Domains in SCOPe 2.07: d1y9ib_
  • Chain 'C':
    Compound: low temperature requirement C protein
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZIM5
      • modified residue (73)
    Domains in SCOPe 2.07: d1y9ic_
  • Chain 'D':
    Compound: low temperature requirement C protein
    Species: Listeria monocytogenes [TaxId:1639]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q9ZIM5
      • modified residue (73)
    Domains in SCOPe 2.07: d1y9id_
  • Heterogens: CA, MG, GOL, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >1y9iA (A:)
    mslvekqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkre
    vqnavltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyi
    dkvkpgilaklnehdgiavhtflddivgaiaaaaasrlahsyhddivneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9iA (A:)
    kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav
    ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp
    gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >1y9iB (B:)
    mslvekqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkre
    vqnavltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyi
    dkvkpgilaklnehdgiavhtflddivgaiaaaaasrlahsyhddivneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9iB (B:)
    kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav
    ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp
    gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >1y9iC (C:)
    mslvekqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkre
    vqnavltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyi
    dkvkpgilaklnehdgiavhtflddivgaiaaaaasrlahsyhddivneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9iC (C:)
    kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav
    ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp
    gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >1y9iD (D:)
    mslvekqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkre
    vqnavltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyi
    dkvkpgilaklnehdgiavhtflddivgaiaaaaasrlahsyhddivneggshhhhhh
    

    Sequence, based on observed residues (ATOM records): (download)
    >1y9iD (D:)
    kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav
    ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp
    gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd