Lineage for d1y9ia_ (1y9i A:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2736339Fold a.195: YutG-like [101306] (1 superfamily)
    core: 6 helices; bundle; one central helix is surrounded by 5 others
  4. 2736340Superfamily a.195.1: YutG-like [101307] (1 family) (S)
  5. 2736341Family a.195.1.1: YutG-like [101308] (3 proteins)
    Pfam PF01892; DUF64
  6. 2736345Protein Low temperature requirement C protein, LtrC [116955] (1 species)
  7. 2736346Species Listeria monocytogenes [TaxId:1639] [116956] (1 PDB entry)
    Uniprot Q9ZIM5
  8. 2736347Domain d1y9ia_: 1y9i A: [116586]
    Structural genomics target
    complexed with ca, gol, mg

Details for d1y9ia_

PDB Entry: 1y9i (more details), 1.8 Å

PDB Description: crystal structure of low temperature requirement c protein from listeria monocytogenes
PDB Compounds: (A:) low temperature requirement C protein

SCOPe Domain Sequences for d1y9ia_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9ia_ a.195.1.1 (A:) Low temperature requirement C protein, LtrC {Listeria monocytogenes [TaxId: 1639]}
kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav
ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp
gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd

SCOPe Domain Coordinates for d1y9ia_:

Click to download the PDB-style file with coordinates for d1y9ia_.
(The format of our PDB-style files is described here.)

Timeline for d1y9ia_: