Lineage for d1y9ib_ (1y9i B:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2014573Fold a.195: YutG-like [101306] (1 superfamily)
    core: 6 helices; bundle; one central helix is surrounded by 5 others
  4. 2014574Superfamily a.195.1: YutG-like [101307] (1 family) (S)
  5. 2014575Family a.195.1.1: YutG-like [101308] (3 protein domains)
    Pfam PF01892; DUF64
  6. 2014579Protein Low temperature requirement C protein, LtrC [116955] (1 species)
  7. 2014580Species Listeria monocytogenes [TaxId:1639] [116956] (1 PDB entry)
    Uniprot Q9ZIM5
  8. 2014582Domain d1y9ib_: 1y9i B: [116587]
    Structural genomics target
    complexed with ca, gol, mg

Details for d1y9ib_

PDB Entry: 1y9i (more details), 1.8 Å

PDB Description: Crystal structure of low temperature requirement C protein from Listeria monocytogenes
PDB Compounds: (B:) low temperature requirement C protein

SCOPe Domain Sequences for d1y9ib_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1y9ib_ a.195.1.1 (B:) Low temperature requirement C protein, LtrC {Listeria monocytogenes [TaxId: 1639]}
kqsaleskarswliergveiddiaelvlflqqkyhpgleldicrqnvehvlrkrevqnav
ltgiqldvmaekgelvqplqniisadeglygvdeilalsivnvygsigftnygyidkvkp
gilaklnehdgiavhtflddivgaiaaaaasrlahsyhd

SCOPe Domain Coordinates for d1y9ib_:

Click to download the PDB-style file with coordinates for d1y9ib_.
(The format of our PDB-style files is described here.)

Timeline for d1y9ib_: